PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D11G1832
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 167aa    MW: 19021.1 Da    PI: 6.6266
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D11G1832genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.41.2e-113184558
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58
                 ++ +r+++NReAA rsR RK+++++ L   v +L  eN +   +++  ++ + +
  Gh_D11G1832 31 RKRKRMASNREAACRSRMRKQKQLDDLMGQVSQLAHENNQILVNINITTQIYLN 84
                 5789**********************************9988887766666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.4E-132791IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.7262971IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.3E-102972No hitNo description
SuperFamilySSF579591.27E-113184No hitNo description
PfamPF001703.6E-93175IPR004827Basic-leucine zipper domain
CDDcd147021.24E-143282No hitNo description
PROSITE patternPS0003603449IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MATSRTGSSS SSTTPRSSSS VEEFQQVLNE RKRKRMASNR EAACRSRMRK QKQLDDLMGQ  60
VSQLAHENNQ ILVNINITTQ IYLNIEAENA VLRAQMAELS TRLQSLNEIN DFINSNNGVF  120
GYDHPNNYEA AHDHHHHQVN DDTFMNNPWG CFYGNQPLIA SADMIMY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13051RKRKRMASNREAACRSRMRKQK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012491624.11e-104PREDICTED: ocs element-binding factor 1-like
TrEMBLA0A0D2TI921e-104A0A0D2TI92_G
STRINGPOPTR_0005s25290.12e-50(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50128154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18160.11e-41basic leucine-zipper 2